AS-TESA

$79.99

Independent labTested per lot
Coded labelOpens the lot report
Fast dispatchShips in one business day

Investigational use only Not for use in humans In vitro tests and laboratory research animals only Not approved by the FDA Read the full disclaimer →Who we supply →

CAUTION: Contains a new drug for investigational use only in laboratory research animals, or for tests in vitro. Not for use in humans.

Lot results

Per certificate

Molecular weight: 5136 g/mol
CAS: 218949-48-5
Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Form: Lyophilized powder
Storage: −20 °C, away from light

AS-TESA is a synthetic 44-amino-acid peptide. It is an analog of human growth-hormone-releasing hormone with a trans-3-hexenoyl group added at one end of the chain.

Type: Synthetic 44-amino-acid peptide
Molecular weight: about 5136 Da
Size: 10 mg per vial.

Supplied as a lyophilized (freeze-dried) powder in a sealed glass vial. Store sealed at −20 °C, away from light and moisture.

Identity, purity and fill results for the lot you receive are on its certificate of analysis.

For in-vitro laboratory research only. Not for human or veterinary use.

◆Compound data

Material data

Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular formula: C221H366N72O67S
Molecular weight: 5136 g/mol
CAS number: 218949-48-5
Form as supplied: Lyophilized powder
Sizes: 10 mg

Figures describe the material as supplied. Identity, purity and fill results for the lot you receive are on its certificate of analysis.

◆Handling

Storage and handling

On arrival

Lyophilized material is shipped at ambient temperature and is stable in transit. Move it to cold storage when it arrives, and inspect the seal before storing.

Temperature

−20 °C for long-term storage. 2 to 8 °C is adequate for short periods. −80 °C extends shelf life further.

Freeze-thaw

Repeated freeze-thaw cycles degrade peptides. Allow a vial to reach room temperature before opening, and avoid cycling the same vial more than necessary.

Moisture and light

Lyophilized peptides are hygroscopic. Keep vials sealed, store with desiccant where possible, and keep them away from direct light.

Records

Record the lot number from the label in your laboratory notes. The lot report is linked from this page.

Disposal

Dispose of vials and unused material following your institution's laboratory waste procedures and the rules that apply where you are.